Busca avançada
Ano de início
Entree

Inativação do vírus Zika mediado por nanopartículas decoradas com peptídeos

Processo: 18/15042-4
Linha de fomento:Auxílio à Pesquisa - Regular
Vigência: 01 de novembro de 2018 - 31 de outubro de 2020
Área do conhecimento:Ciências Exatas e da Terra - Química - Físico-química
Convênio/Acordo: University of Miami
Proposta de Mobilidade: SPRINT - Projetos de pesquisa - Mobilidade
Pesquisador responsável:Mateus Borba Cardoso
Beneficiário:Mateus Borba Cardoso
Pesq. responsável no exterior: Marc R. Knecht
Instituição no exterior: University of Miami, Estados Unidos
Instituição-sede: Centro Nacional de Pesquisa em Energia e Materiais (CNPEM). Ministério da Ciência, Tecnologia, Inovações e Comunicações (Brasil). Campinas , SP, Brasil
Vinculado ao auxílio:15/25406-5 - Organizando a matéria: colóides formados por associação de surfactantes, polímeros e nanopartículas, AP.TEM
Assunto(s):Inativação de vírus  Vírus Zika  Nanopartículas  Sílica  Peptídeos  Tensoativos anfóteros  Coloides  Cooperação internacional 

Resumo

A proposta aqui descrita tem como objetivo sintetizar nanopartículas de sílica fluorescentes e recobri-las simultaneamente com dois peptídeos distintos, usando sequências de direcionamento para ancorar essas biomoléculas funcionais à superfície das nanopartículas. O primeiro é um peptídeo zwitteriônico com uma sequência terminal RERERE, para conferir estabilidade coloidal e evitar a formação de "protein corona" sobre as partículas. O segundo é um peptídeo de direcionamento de sequência MAVLGDTAWDFGSVGGALNSLGKGIHQIFGAAF, que deverá induzir a interação entre as nanopartículas e vírus Zika, consequentemente, inativando a capacidade viral de infectar células saudáveis. A atividade biológica das partículas sintetizadas será testada contra vírus Zika nativo. (AU)